Shop/bundles/Retatrutide 10mg — Box of 10
Retatrutide 10mg — Box of 10
bundles

Retatrutide 10mg — Box of 10

SKU: MC-RETA-10-BX10
$1,039.92

Box of 10 vials of Retatrutide 10mg. 10 for the price of 8 — bulk research supply.

Size
Research Use Only Documentation Available UPS 2nd Day Air $10.99
Key specifications
CAS Number
2381089-83-2
Molecular Formula
C221H342N46O68
Molecular Weight
~4731.33 g/mol
Physical Appearance
Fine White Lyophilized Powder

Box of 10 vials of Retatrutide 10mg, priced at 10 for the price of 8 for stocked research programs. Retatrutide research peptide, 10mg per vial. Supplied for research use only. Not for human consumption.

Technical Notes

For research use only. Not for human consumption.

Properties

Vials per box
10
CAS Number
2381089-83-2
Synonyms
GGG Tri-agonist, LY3437943
Sequence
YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
Molecular Formula
C221H342N46O68
Molecular Weight
~4731.33 g/mol
Physical Appearance
Fine White Lyophilized Powder
Pubchem LCSS
CAS: 2381089-83-2 Laboratory Chemical Safety Summary
Terms
Laboratory research use only (RUO). Not for human, animal, diagnostic, or household use.
Storage
Store at -20°C, protected from light and moisture.

From our lab to yours.

Premium-grade research products, carefully processed and handled by our team for a reliable, seamless experience.


Disclaimer: These products are intended for laboratory research purposes only, and are not for human or animal consumption. The products are not intended to diagnose, treat, cure, or prevent any disease. The products should not be used as a food, drug, cosmetic, or other household use. By accessing this website or purchasing from this website, you agree that it is your sole responsibility to ensure compliance with applicable laws and regulations within your jurisdiction; and you understand and acknowledge that no information on this website should be construed as medical advice. You also acknowledge and agree that you have read the Terms of Service available on this website and agree that your rights and responsibilities are governed by the Terms of Service on this website. Miami Chem is a chemical supplier and is not a compounding pharmacy or chemical compounding facility as defined under Section 503A of the Federal Food, Drug, and Cosmetic Act. Additionally, Miami Chem is not an outsourcing facility as defined under Section 503B of the same Act.

2026 Miami Chem. All rights reserved.

VISA
AMEX